該頁無縮略圖
Overview
Widelyusedinurbanpowergridtransformationresidentialdistricts,commercialcentersandotherdenselypopulatedareas.
Modelandmeaning
Features
Prefabricatedliecablesobbleadfullaldfuulatedntcefreebleantefa safety;
compactstructure,smalland beautifulappearance,stainless steel double box,theservicelifeofup to20 years;
Underthepremiseofnotafectingtheoperationof themainnetwork,realizeregionaloutagemaintenanceandreducethescopeof power outage;.
Canbeequippedwithoneormore SF6loadswitches.Thewiringisflexibleanddiverse,withupto8loopsinthebranchoutlet;
optionalarrester,short-ircuitfultinicator,urrntlimitingfuses,etc.tomeetteuser'sriousrequirements.
Themaintechnicalparameters
| No | Name | Parameter |
| 1 | Rated voltage | 12kV |
| 2 | Rated current | 630A |
| 3 | Frequency withstand voltage (phase) | 42kV/min |
| 4 | Lightning impulse voltage | 75kV |
| 5 | Rated breaking current | 630A |
| 6 | Rated short-circuit opening and closing current (peak) | 50kA |
| 7 | Ratedshort-timewithstandcurrent | 25kA/4S |
| 8 | Rated peakwithstand current | 50kA |
| 9 | Rated breaking capacitor current | 45A |
| 10 | Ratedbreaking inductor current | 16A |
| 11 | Full loadbreaking frequency | >100 |
| 12 | Switching and closing machine operation times | 2000 |
Typicalwiringscheme
| Model | Linenumberdescription | Onewiringdiagram | Appearancesize (length×width ×height) | |
| DFWK-102K | One into two branches with a switch | 1180×1050×1600 | ||
| DEWK-103K | One into three branches with a switch | 8 | 1250x 1050x1600 | |
| DFWK-104K | One into four branches withaswitch | 8 | 1250×1050×1600 | |
| DFWK-112K | One in and one out two brancheswithaswitch | 1350×1050×1600 | ||
| DEWK-113K | One into three branches witha switch | 1 | 1420x 1050x1600 | |
| DFWK-114K | One into four branches with a switch | 1420x 1050x 1600 | ||
Overview
DFW-12outdoorACcablebranchboxisacableengineeringequipmentwidelyusedinpowerdistrbutionsystem.Itsmainfeatures aretwo-waydooropeningandusingbut bushingasconnectionbus-bar.Ithasremarkableadvantagessuchassmallengthclear cablearrangementandnoneedforlargespancrossingofthreecorecable.ThecableconnectorsareinaccordancewiththeD47636 standard.
Therated current 63oA bolt fixed connection type cable joint is generally adopted.
Structuralfeatures
1.Full insulation,fully sealed structure,full protection,full working conditions;
2.Flexible entry and exit,the actual application of the most branches and exports of eight branches;
3. Anti frost, anti condensation;
4.With semi conductive shielding layer of silicone rubber cable connector, to ensure personal safety;
5.The realization of district multi-channel transmission.
6.The cable head is touch type.
Themaintechnical parameters
| Technicalindicators | parameter |
| Rated voltage | 10kV |
| Maximum operating voltage | 12kV |
| Rated current | 630A |
| Power frequency withstand voltage (phase to ground) | 45kV/1min |
| Partial Discharge | |
| Impulse voltage | 105kV |
| DC withstand voltage | 52kV/15min |
Typicalsolutionwiring
| Model | Aplan | Size (Wx D x H) |
| DFW10-12-3 | H | 890×720×980 |
| DFW10-12-4 | 890×720×980 | |
| DFW10-12-5 | 1170×720×980 | |
| DFW10-12-6 | 1170×720×980 |
Ordinaryfourbranchcablebranchboxstructurediagram
1.Socket 8.Stud bolts
2. Stud bolts 9. Nuts
3. Plug 10.Blocking cover
4.Wire ear 1.Application Cone
5.Gasket 12. Ground wire
6.Spring washer 13. Installation paste
7. Silicone rubber joint
| Stressconenumber | Cablesurface | Coreinsulationdiameter |
| 5002 | 25-35 | 14.8-19.2 |
| 5003 | 50-95 | 17.0-24.3 |
| 5005 | 120-240 | 22.4-33.6 |
| 5410 | 300-400 | 30.9-36.1 |
JHR-400
Low-voltagecabledistributionbox
Respectingpromiseandkeepingpromise,operating intherightway,strivingfor perfection,coexistenceandwin-winsituation
Ordinaryfourbranchcablebranchboxstructurediagram
JHR-40 low-voltagecabledistributionboxisakindofelectriccable tootherequipment (non-powerconsumptionequipment) toalocateowrtstalltdosaliofodtspntodoedotedngd embeddedIntothetypeof4,itisusedforpublicthree-phasesystem.ProductsmeetGB7251.5andIC439-1(1992)andother standards.
Modelandmeaning
Useenvironmentalconditions
1.The cabinet selection of 1 . 5 \mathsf {mm } thick cold-rolled steel or 1 . 2 \mathsf {mm } thick stainless steel production,the surface of the acid sprayed spray treatment,beautifulappearance.
2.The left and right sides of the box into the line,the following outlet hole,easy access.
3.The cabinet has a main grounding point, easy to connect with the ground.
4Boxbfldaigrtsidakssacileiosisistacedig resistance.
5.Theappearanceof the protection level IP34D,when thecableisconnected,the minimumprotection levelP23C.
Themaintechnical parameters
| Serial number | project | parameter |
| 1 | Rated insulationworking voltage | 400 |
| 2 | Rated operating voltage | AC380、AC220 |
| 3 | Maximum rated current | 100A |
| 4 | Shorttimewithstandcurrent | 6kA |
| 5 | Protectionclass | IP30 |
MNS
Low Voltage Switchgear Series
Respectingpromiseandkeepingpromise,operatingintherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
MNSLVwithdrawableswitchgear (hereinafterreferedtoasdevice)ismanufacturedbystandardmodule throughconsultingMNS serieslowvagswihabinetofSwitzerndBBCmpanyandstheticallyiproedTeviceisplicabletoteeih AC50Hz,ratedorkingvoage6Vandelowusedascontroldeviceforvariouspowergenerationtransmisiondistributioower transferandpowerconsumptiondevie.Itiswidelyusedinlowvoltagedistributionsystemofvariousminingenterprise,tallbuildingand hotelmunicipructitcsidstealndssialspoaliondfoierll platform and nuclear power station.
The device accords with international standard IEC439-1 and national standard GB7251.1.
Mainfeature
1.Compact design:Contain more function units with less space.
2.Strong versatility for structure,flexible assembly. C type bar section of 2 5mm modulus can meet the demands of various structure and type,protection gradeand operating environment.
3.Adoptstandardmoduledsigncanbecominedintoprotectionprationtransferontrolegulationmasrent
indicationetcsuchstandardunits.Usercanchooseassemblyacordingtorequirementatwill.Cabinetstructureanddrawerunitanbe formed with more than 200 components.
4.FinesecurityAdopthighstrengthantifamingtypengineeringplasticpackinargeqantitytoffctivelyancetheprotective safetyperformance.
5.High technical performance:Main parameters reach the advanced level at home.
Themaintechnical parameters
| Ratedworking voltage(V) | Rated insulation voltage(V) | Ratedworking current(A) | Ratedstiitsd | Peel tion、ipeof | ||
| Horizontalbus bar | Verticalbusbar | Horizontalbusbar | Verticalbusbar | Outline dimension H×W×D | ||
| 380、660 | 660、1000 | 630-5000 | 800-2000 | 50-100/105-250 | 60/130-150 | 200X600000 |
Structuralfeatures
Thebasiccabinetofdeviceiscombinedassemblystructure.Basicstructuralpiecesofcabinetiszincplated,connectedandfired intobasicbracketthroughselftappinglockingscrewor8.8gradesquarecornerscrew.Accordingtothechangedemandofproject adinallyaddspingingdflealopndotfs assembleacomplete setof device.Perform modulusto interior component and compartment size (Modulus unite = 2 5mm ）
Useenvironmentalconditions
1.Ambient air temperature: - 5 ^ { \circ } C ~ + 4 0 ^ { \circ } C and the average temperature should not exceed + 3 5 ^ { \circ } C in 24h.
2.Aircondition:With clean air.Relative humidity should not exceed 50 % at + 4 0 ^ { \circ } C .Higher relative humidity isallowed at lower temperature.Ex. 90 % at + 2 0 ^ { \circ } C .But in view of the temperature change,it is possible that moderate dews willproduce casually. 3.Altitude above sea level should not exceed 2000M.
4.The device is suitable to the transportation and store with following temperature - 2 5 ^ { \circ } C - + 5 5 ^ { \circ } C ,in short time (within 24h) it reaches + 7 0 ^ { \circ } C .Underthelimiting temperature,device should notsuferdamage thatcan’t recover,and itcan works normally under normal conditions.
5.If the above operating conditions not meet user's demand. Consult with manufactory.
6.Technicalagreementshouldbesignedadditionallyifthedeviceisusedformarinepetroldrlltakenplatformandnuclearpower station.
GGD
AC low-voltage fixed switchgear
Respectingpromiseandkeepingpromise,operatingintherightway，strivingfor perfection,coexistenceandwin-winsituation
Overview
GGDAC LV fixed type switchgear is applicable to the distribution system with AC 5 0 H z rated working voltage 380V,rated current to350Abelowiatiostationtteceotrsestrtiodtooid distribution devices.
Theproducthaaracteristicsofghbeakingapacityfinedamicndtralsabityfexibleectricprojectot combination,betterserial practicability,novel structureand high protection grade etc.
ItaccordswiththestandardsEC439"Lowvoltagecompleteswitchdeviceandcontroldevice"andGB7251.1Lowvoltagecomplete switch device" etc.
Mainfeature
1.ThebodyofGGDACLVfixedtypeswitchgearadoptsuniversalcabinetype.Framework isassembledwith8MFcold bending barsteelthroughpartwelding.Frameworkcomponentsandspecialmatingelementsarematchedbybarstelpointedmanufactoryfor ensuringtheprecisionandqualityofcabinetComponentsofuiversalcabinetisdesignedaccordingtomoduleprincipleandwith20 modulus mounting hole and high universal coeficient.
2.Completelyinviewoftheheatrejectionduringcabinetruning.Heatrejectionslotsofdfrentquantitiesareinstallediupper andundersidebothendsofcabinet.
3.According totherequirementsonmolddesignformodernindustryproducts,doptingthemethodofgoldenmeanratiotodesign cabinet outlineand parting dimensions of each part,to make the whole cabinet beautifuland decent.
4.Cabinetgateisconnectedwithframeworkwithrotationaxistypemovablehinge.Withconvenientinstalationanddisassmbly One mount type rubber strip is set in edge fold of gate.
Fillrodbetweengateandframeworkhascertaincompressionstrokewhenclosing thegate.Itcanpreventgatefromimpacting cabinet directly and also advance the protection grade for gate.
5.Connectemetergatesetwith electricalcomponentswith frameworkbymulti-strandsoftcopperwire.Connectthemounting pieces inside thecabinet with framework by knurled screws.
Thewhole cabinet constructs complete earthing protective circuit.
6.Topcoverofcabinetcanbedisassembledifnecessaryforconveniencetotheassemblyandadjustmentformainbusbaratsite. Foursquares of cabinet are set with slinger for hoisting and shipping
7.Protection grade of cabinet: IP30.User can choose within IP20.IP40 according to environmental requirements.
Themaintechnicalparameters
| Type | Rated voltage(V) | Ratedcurrent(A) | Ratedshortcircuit breakingcurrent | Ratedshorttime withstandcurrent | Ratedpeakwithstand current |
| GGD1 | 380 | 1000 600(630) 400 | 15 | 15(1S) | 30 |
| GGD2 | 380 | 1500 1600 1000 | 30 | 30(1S) | 63 |
| GGD3 | 380 | 3150 (2500) 2000 | 50 | 50(1S) | 105 |
Useenvironmentalconditions
1.Ambient air temperature: - 5 " C ~ + 4 0 C and the average temperature should not exceed + 3 5 ^ { \circ } C in 24h. 2.Installand use indoors.Altitude above sea level for operation site should not exceed 2000M. 3.Relative humidity should not exceed 50 % atmax temperature \yen 400 .Higher relative humidity isallowed at lower temperature. X. 9 0 % at + 2 0 c .But in view of the temperature change,it is possible that moderate dews willproduce casually. 4. Installation gradient not exceed 5 ^ { \circ } 5.Installinthe placeswithoutfierce vibrationand shockandthesites insuffcienttoerode the electricalcomponents. 6.Any specific requirement,consult with manufacturer.
Internalstructure
| Productcode | A | B | C | D |
| GGD06 | 600 | 600 | 450 | 556 |
| GGD06A | 600 | 800 | 450 | 756 |
| GGD08 | 800 | 600 | 650 | 556 |
| GGD08A | 800 | 800 | 650 | 756 |
| GGD10 | 1000 | 600 | 850 | 556 |
| GGD10A | 1000 | 800 | 850 | 756 |
| GGD12 | 1200 | 800 | 1050 | 756 |
Examplescenario
| Schemenumber | 1 | 2 | 3 | 4 | 5 | 6 | |||||||||||||||
| Main circuit scheme diagram | ① | ||||||||||||||||||||
| Electrification | Electrification | Electrification | Electrification | Electrification | |||||||||||||||||
| Electrical element of main circuit | Purpose Modelspecification | A | Electrification | C | A | Feeding | C | ||||||||||||||
| HD13BX-1000/31 | B | C | A | B | 1 | B | C | A | B | C | A 1 | B | A | B | C | ||||||
| HD13BX-600/31 | 1 | 1 | 1 | 1 | 1 | 1 | |||||||||||||||
| HD13BX-400/31 | 1 | 1 | 1 | 1 | 2 | 2 | 2 | ||||||||||||||
| DW15-1000/3[] | 1 | ||||||||||||||||||||
| Electric DW15-63netI1m | 1 | ||||||||||||||||||||
| DW15-400/31 | |||||||||||||||||||||
| CJ20-400/3 | 1 | ||||||||||||||||||||
| CJ20-250/3 | 2 | ||||||||||||||||||||
| CJ20-160/3 | 2 | ||||||||||||||||||||
| LMZ1-0.66[]/5 | 1 | 1 | 1 | 3 | 3 | 3 | 2 | ||||||||||||||
| LMZ3-0.66[]/5 | 2 | 2 | |||||||||||||||||||
| (LMZ1-0.66[]/5) | |||||||||||||||||||||
| Cabinet widthmm | 600 | 600 | 600 | 1000 | 800 | 800 | 1000 | 800 | 800 | 600 | 600 | 600 | 800 | 800 | 800 | 800 | 800 | 800 | |||
| Cabinetdepthmm | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | |||
| Schemenumber | 2 | 3 | 4 | 5 | 6 | |||||||||||||||
| Maincircuit scheme diagram | ||||||||||||||||||||
| Purpose | Electrification | Electrification | Electrification Interconnection | Electrification Interconnection | Electrification | Electrification | ||||||||||||||
| Model | A | Interconnection B | C | A | Interconnection B | C | A B | C | A | C | Interconnection B | C | ||||||||
| Electrical element of main circuit | specification HD13BX-1000/31 | 1 | B | A | B | C | A | |||||||||||||
| 1 | 1 | 1 | 2 | 2 | ||||||||||||||||
| HD13BX-600/31 | 1 | 1 | 1 | 1 | 2 | 2 | 2 | |||||||||||||
| HDW135-X-40031 | 1 | 1 | 1 | 1 | 2 | |||||||||||||||
| Electric DW15-630/3I1m | 1 | 1 | 1 | 1 | 1 | |||||||||||||||
| DW15-400/3[] | 1 | 1 | 1 | 1 | ||||||||||||||||
| Electromagnetism | 1 | 1 | 1 | |||||||||||||||||
| LMZ3-0.66[]/5 | 3（4) | 3(4) | 3（4) | 3（4) | 3（4) | 3（4) | 3（4) | 3（4) | 3（4) | 3（4) | 3（4) | 3（4) | 3（4) | 3(4) | ||||||
| (LMZ1-0.66[]/5) | 3(4) | |||||||||||||||||||
| Cabinet widthmm | 600 | 600 | 600 | 800 | 800 | 800 | 1000 | 800 | 800 | 1000 | 800 | 800 | 1000 | 800 | 800 | 1000 | 800 | 800 | ||
| Cabinetdepthmm | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | 600 | ||
GGJ
Low-voltage reactive power intelligent compensation device
Respectingpromiseandkeepingpromise,operatingintherightway，striving for perfection,coexistenceandwin-winsituation
Overview
GGJlow-voltage reactivepowercompensation device using computer-aideddesign (CAD),theintroductionof microcomputer controlnteltbd Low-voltagepowergridmpoewerctoduceactirsroeoweruaityeatio saving products.Dedicated to the 130-6ooK VA three-phase transformer reactive power compensation.
Modelandmeaning
Workingconditions
altitude: S 2 0 0 0 \mathsf { m }
Ambienttemperature: - 2 0 ^ { \circ } mathsf { C } ~ + 4 5 ^ { \circ } \mathsf { C }
relative humidity S 9 0 % at20 C;
installation environment: no harmful gases and steam,no conductive orexplosive dust and serious mold.
Mainfeature
Intlligentoltfulurdbefctoticpiosewcrt Real-time display power grid power factor,display range: lag (0.oo-0.99),ahead (0.00-0.99);
Withover-voltage,harmonic,overcompensation,systemflure,lackofpase,overloadandothercomprehensiveprotection; Memoryhaseensetprameters,thesstemwillnotosetheparametersfterpowerfiure,thegridbacktoomalutomaticaly enter the running state,no personnel on duty;
According to the grid load balance,to take the phase compensation or mixed compensation;
Anti-interferenceabiltcanithstandtedirectinputfromthegridmplitdeofVinterferencepulseghertantheational professional standards.
Themaintechnicalparameters
Rated voltage:0.38-0.66kV;
Rated frequency: 50Hz;
Rated capacity:1-600kvar;
Applicable voltage range:(0.85-1.1) times the rated voltage;
Maximum allowable current:1.3 times the rated current;
Control circuit: 1-16 loop;
Switching time:1-150s1 times,adjustable;
Work:automatic,continuous operation.
Distributionnetworkdetectionfunction
real-timemeasurementandthewholepointof therecordtransformerlow-voltagesideof thethree-phasevoltage,current, frequencycticictocicirtotad Subharmonic content;
RS-232andRS-485interface,canbe handheldcomputerdatacopy,butalsothroughtheremotecommunicationfunction to achievewirelessmeterreading,devicetesting,parametersetingsandtimemeasurementdataandrecordsDatareading;
dataanalysisfunctionteprationladdatacanbenalyedandprocessed,statisticalquery;omprehensiveaalysisfpower supplyqualitylculatetheagessateoweupplyloadrateelabilityndimuladrateQueryowrctocie powerandreactivepowerdrawachaseoageurrntowerfctorre;printomprehensiveaysisdstatisticalorts.
GCK Low Voltage Switchgear Series
Respectingpromiseandkeepingpromise,operating intherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
GCKLVwithdrawableswitchgearcabinetisapplicabletothelowvtagedistributionsystemwithAC50Hz,ratedworkingvoltage 380V.Itcontainspowercenter(PC)andmotorcontrolcenter(MCC)functions.Eachtechnicalparameterallreachesnationalstandard Withcharacteristisofdvancedtructure,autifulappearance,gelectricformance,ighprtectongradeeliablde andeasytointainItitdealisritioneviforwaeoweupplyteinetalurgytrolale machineryand lightweavingindustriesetc
The product accords with standards IEC-439,GB7251.1.
Designfeature
1.GCK1and REGCJ1areassemble typecombined structure.Thebasic skeletonisassembled byadopting special barsteel. 2.Cabinet skeleton,component dimension and starter size change according to basic modulus E = 2 5mm
3.InMCCprojectpartsincabinetaredivdedintofivezones(compartment)：orizontalbusbaoneverticalbusbaonefunction unit zone,cablecompartment,andneutralearthingbusbarzone.Eachzoneisseparatedmutuallforcircuitsnormalrunningand effectivelypreventing fault expansion.
4.Asallstructuresofframeworkareconectedandfiedbybolts,soitvodstheeldingdistortioandstressandupradesthe precision.
5.Strong general performance,wellapplicability and high standardization degree for components.
6.Draw-out and insertoffunctionunit (drawer)is leveroperation,which iseasyand reliable with roling bearing.
Useenvironmentalconditions
1.Altitudeabovesealevelshouldnotexceed2000M.
2.Ambientair temperature: - 5 ^ { \circ } C ~ + 4 0 ^ { \circ } C and the average temperature should not exceed + 3 5 ^ { \circ } C in 24h.
3.Aircondition:Withcleanair.Relative humidityshould notexceed 50 % at + 4 0 ^ { \circ } \mathsf C .Higherrelative humidityisallowedat lower temperature.Ex. 90 % at + 2 0 ^ { \circ } C ：
4.Places without fire,explosive danger,serious polution,chemical corrosionand fierce vibration.
5.Installation gradient not exceed 5 ^ { \circ } ：
6.Control center issuitable to the transportationand store with following temperature : - 2 5 ^ { \circ } C ~ + 5 5 ^ { \circ } C ,inshort time(within24h) it should not exceed + 7 0 ^ { \circ } C ：
Themaintechnicalparameters
| Protection grade | IP40、IP30 | |
| Rated working voltage | AC、380(V) | |
| Frequency | 50Hz | |
| Rated insulation voltage | 660V | |
| Working conditions | ||
| Environment | Indoors | |
| Altitude | ≤2000m | |
| Ambient temperature | -5°℃~+40℃ | |
| The min temperature under store and transportation | -30°℃ | |
| Relative humidity | ≤90% | |
| Capacity of control motor(kW) | 0.4-155 | |
| Rated current(A) | ||
| Horizontal bus bar | 1600、2000、3150 | |
| Vertical bus bar | 630、800 | |
| Contact connector of main circuit | 200、400 | |
| Supply circuit | 1600 | |
| Max current | PC cabinet | 630 |
| Power receiving circuit | MCCcabinet | 1000、1600、2000、2500、3150 |
| Rated short time withstand current(kA) | ||
| Virtual value | 50、80 | |
| Peakvalue | 105、176 | |
| Line frequency withstand voltage(V/1min) | 2500 | |
GCS Low Voltage Switchgear Series
Respectingpromiseandkeepingpromise,operating intherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
GCSLVwithdrawableswitchgear(hereinafterreferedtoasdevice)isdevelopedaccording totherequirementsfromindustry competentdepartment,numerouselectricusersanddesignunitbyriginalstatemechanicaldepartment,uniteddesigngroupof powerdepartment.Itonformstonationalconditionsandwithighertechnicalperformanceindexandadaptsthedemandsforpower marketdevelopmentandabletocompetewithavailableimportedproducts.Thedevicepasedtheauthenticationjointlypresidedby twodepartmentsinJuly1996inShanghai.Itobtainstherecognitionandafirmationfrommanufacturingunitandpowerconsumer construction.
Thedeviceisapplicabletothedistributionsystemofpowerstation,petroleum,chemicalngineering,metalrgyeavingnd tallbuildngidustriesetc.Intheplaceswithhighautomaticityandnedcomputertojoint,suchaslarge-scalepowerstationand petrochemicalindustrysystemetc.itistelowvoltagecompletedistributiondeviceusedinthegeneratingandpowersuplyystem with three-phase \mathsf { A C } 5 0 ( 6 0 ) \mathsf { H } z ,rated working voltage 38oV,rated currnt 40o0A and below for distribution,motor central control and reactive power compensation.
The device accords with standards IEC439-1 and GB7251.1.
Mainfeature
1.Main framework adopts8MF barsteel.Both sides of barsteel is installed with \Phi 9 . 2 \mathsf {mm } mounting hole with modulus 2 0mm and
100mm.Inner installation is flexible and easy. 2.Twotypesofassembly formdesignformainframework,fullassemblystructureandpartal(sideframeandcrossrail)welding
structureforuserselection. 3.Each functioncompartmentofdeviceisseparatedmutuall.Thecompartmentsaredividedintofunctionunitcompartmentbus
bar compartment and cable compartment. Each one has relative independent function. 4.Horizontalbusbaradoptscabinetbacklevelplacedarraypatternforenancingthecapacityofresistingelectrodynamicforcefor
bus bar.It is the basic measure for obtaining high short circuit strength capacity for main circuit. 5.Cable compartment design makes cable outlet and inlet up and down convenient.
Themaintechnicalparameters
| Ratedvoltage of maincircuit (V) | |
| AC 380(400)、 (660) | Rated short time withstand current of bus bar (kA/1s) 50、80 |
| Rated voltage of auxiliary circuit(V) | Rated peak withstand current of bus bar (kA/0.1s)105、176 |
| AC 220、380(400) | Line frequency test voltage(V/1min) |
| DC 110、220 | Main circuit 2500 |
| Rated frequency(Hz) 50(60) | Auxiliary circuit 1760 |
| Rated insulationvoltage(V) 660(1000) | Bus bar |
| Rated current(A) | Three-phase four-wire system A.B.C.N |
| Horizontal bus bar ≤4000 | Three-phase ve-wire system A.B.C.PE.N |
| (MCC) Vertical bus bar 1000 | Protection grade IP30、IP40 |
Useenvironmentalconditions
1.Ambientairtemperature: - 5 ^ { \circ } C ~ + 4 0 ^ { \circ } C andtheaverage temperatureshould not exceed + 3 5 ^ { \circ } C in 2 4 \mathsf { h }
2.Relative humidity should not exceed 50 % atmax temperature.Higher relative humidity isallowed at lower temperature.Ex. 9 0 % at + 2 0 ^ { \circ } C .Butin view of the temperature change,it is possible that moderate dews willproduce casually.
3.Altitudeabove sea level should not exceed 2000M.
4.Installation gradient not exceed 5 ^ { \circ } ：
5. Indoor without dust, corrosive gas and rain waterattack.
Internalstructure
| High(H) | 2200 | |||||||||
| Wide(W) | 400 | 600 | 800 | 1000 | ||||||
| Deep(D) | 800 | 1000 | 800 | 1000 | 600 | 800 | 1000 | 600 | 800 | 1000 |
GZDW
DC power screen
Respectingpromiseandkeepingpromise,operatingintherightway，strivingfor perfection,coexistenceandwin-winsituation
Overview
This newgenerationofmicrocomputercontroleddirect-currentpowersupplypanelGZDW/GZTWseriesadopts integratedmodule structure,ismainlymposedfmoitoringmoduleectifierodulenslatedmoitoingodleaeryspectionmule/C monitoringmouleiingueoitoringoduletepoduleisribtioitorageterydbitdyed withflexiblefiguationblefomancefrendlyntefcepleerationnteltualidagementtc.uct arewidelyappliedtoriouspowerpants,transformersubstations,mobileommunicationstationindustrialandminingterpris electrifedrilayortsvesgsilingsidentialeastcoanbedratigndotrocef high-voltageitclectromehaicalpotectitomaticevceommuicatioipnt,SCgelectric other equipment.
Modelandmeaning
IndustryStandard
DL/T459-20o0 Specifications of D.C supply cabinet in power system
DL/T637-1997 Specification for order of the valve regulated sealed lead-acid batteries
DL/T724-2000 Specificationof operationand maintenanceofbatteryDC powersupplyequipmentforelectric powersystem
DL/T781-2001 High frequency switching converter module in power system
DL/T856-20o4 DC electrical source supervisor for electric power
DL/T857-2004 Specification of rectification inversion equipment for batery of power plantand substation
DL/T5044-2004 Technical code for designing DC system of power projects
DL/T5120-2000 DC System design code for small electric power project
Scopeofapplication
Thismicrocomputercontrollddirect-curentpowersupplypanelRZ-GZDW-1/2/3/4isanintegratedpowersuplypanelespecialy designedforusersofiferentcapacityThesystemismainlycomposedofmonitoringmodule,ectifermodule,AC/DCmoitoring module,insulatedmoitoringmoduleateryinspetioodule,sitigaluemoitoringodulestep-dwnoduleisfeatuedith stableperfomancefredlyteface,sipleationntellctldagenttcodctsreibletor substatiosofrdted can be used as operatingand control source of high-voltage switch,relay protectionand automatic device.
Themaintechnicalparameters
| Item | Parameterindex |
| Rated input voltage | 380VAC±20% 220VAC±20% |
| Rated output voltage | 220VDC、110VDC |
| Rated output current | 6A、10A、12A、20A、30A、40A、50A、60A、70A、80A、90A、 100A、120A、130A、150A、180A、200A、260A、300A、 |
| Capacity of storage battery | 7Ah、10Ah、20Ah、38Ah、65Ah、100Ah、150Ah、200Ah、300Ah 500Ah、600Ah、800Ah、1000Ah、1500Ah、2000Ah、 |
| Accuracy of voltage stabilization | ≤±0.5% |
| Accuracyofcurrentstabilization | ≤±0.5% |
| Ripple coef cient | ≤±0.1% |
| Frequency of power grid | 50Hz± 10% |
| Powerfactor | >0.95% Full-load output |
| Insulating strength | >10M、2kVAC No ashover or breakdown for 1min |
| Working mode | Long termcontinuousrunning |
| Cooling mode | Intelligent temperature-control type air cooling, high-ef cient natural cooling |
| Audible noise | ≤50dB |
SystemFeatures
1)Two circuits of alternating-current input transferautomatically,ensuring normal running of system;
2)Wide inputvoltage range,strong power grid adaptability;
3)Adoption of high-frequency switching power supply technology, modularized design, N + 1 hot standby,high reliability;
4)Therectifier module adopts live hot plug,convenient and quick daily maintenance;
5)High-accurate dynamic current sharing;independent,controlling or controlled running is available;
6)LCDscreen,touchscreenandcolorizedtouchscreenareavailableforselectionbigscreenwithimagesandcharacters,a riendly interface,simpleand convenient operation;
7)Themonitorwillarryoutallaroundmonitoringandontroltotheunningofsystem,itanealizesstemseingifoation queryaswelloesretottrtelinotetfotuci backgroundmonitoringand remotemonitoring,realizeunattended operation;
8)Themonitorisbletocontroltevoltageofstoragebatterycharging/dischargingcurrentandtemperaturecompensationof storageateryccuratelyaoverundervagendvetmperatureasellasfuasurigotiumstatefoage batery,prolong the service life of storage battery;
9)Functions of manual and automatic voltage regulation,as wellas branch insulation detection;
10)Reliablelightning proofand excellent insulating protectionmeasures,guaranteeingsafetyforsystemand person;
11)RS232and485twoommunicationinterfaceandRU,CDUStheetyesofmmnicationrotocolsidby Ministryof Electric Power forselection;
12) With expansion interface,can switch in other external equipment;
13)Itcanrealizetwogroupsofstoragebateryindependentcharginganddischargingmanagementbyadoptingasetofmonitoring system,two groups of storage battery,two groupsof charging device and bus segment.
Note:AccidentsignalorwaringsignalalarmfunctioandinverterpowersupplyandDCconversionmodulecanbeaddedaccordingto userrequirementsforDC/ACandDC/DCconversion.Seethesystemconfigurationmoduledescriptionforspecificfunctionoperation.
JP
Overview
JPseriesoutdoor integratedpowerdistributionboxisacomprehensivepowerdistributiondevicewiththefunctionsofmetering, outgoingandeactieorompesatio.Itateunctiosofsorticuiteloderoageakageprotectionde utiltyodeldantagsfautifulpperaceoomdpracticabilitndisistalldoeleofudol and transformer,andisanew generationofideal distribution productforurbanand rural power grid transformation.
Modelandmeaning
JP Main circuit program number Transformer capacity Integrated distribution box
Useenvironmentalconditions
1.Environmental temperature:-25degrees, + 4 0 degrees;
2.Air relative humidity:daily average value is not greater than 9 0 % ,theaverage monthly value is not greater than 9 0 %
3.Elevation:no more than 3 0 0 0 \mathsf { m }
4.Installed in the absence of severe shock and shock,non corrosive gas sites.
Structuralfeatures
Thestructureofthecaseisdiscreteandhorizontal.Theshelladopts2mmhighqualitynonpoundsteelplate.Itismadeof multi foldflanging(orstainlesstldoublesandwichplatewithhoneycombstructure).Ithasflameretardance,environmentalprotection heatnsulationandnticondensationPerformance）adoptspecialstainlessteelweldingtechnologyteholestrengthofthebois high,thesufeisgdnchoougefeim;talstaliofa(late) ishot-dipgalvanedproess,tonsurethattentyyearsithoutcorosion;Thefrontandbackdooroftheboxbodyisconvenientfor theusertooperateandexamineandrepair.Thedoorissuroundedbyahighelasticityagingresistantsealingstripandeachdooris providedwithtwooorlocksoflghtandsadendthetransparentlockisprovidedwithnantiblockingndrustprofrainproofover; themeasuringchamberisfullenclosedcosedwithasealingdevice;thesideofteboxisequippedwithcablelinesintotheprofof foreignbodyweartube,botomventilationholesandthecableoutletholeisarrngedonthetopofaventilaionchannelandscreen waterproof,dust-proof,anti rust,anti foreign body function,protection level: IP54.
Themaintechnicalparameters
| Name | Company | parameter |
| Transformer capacity | KVA | 30-400 |
| Ratedworkingvoltage | V | AC400 |
| Auxiliary circuit operating voltage | V | AC220，AC380 |
| Rated frequency | Hz | 50 |
| Rated current | A | |
| Rated leakagecurrent | mA | 30~300Adjustable |
| Protection level | IP54 |
For isolation switch,the model can be selected HD11F series; For the knife melting switch,models available HR5,HR6 and other series; ”For circuit breakers,models are available in DZ20,CM1,NS,DZ47,etc. For the AC contactor,the model can choose CJ20,B series,CJX2,CJ19 switching capacitor series; 中 Zero-sequence transformerand leakage relay, the model is optional JD,LLJ series; For current transformers,models are available in LMZ1-0.5,LMK-0.66 series; For lightning arresters,modelsare available in FYS,Y3W, etc.
A For the capacitor,the model can be selected BSMJ,BCMJ series;
k Forautomatic compensation controller,the model can be selected JKL,JKG series
Compensation circuit number1-4 back optional,each capacity is 3\~20Kvar optional; Another:According to user needs,optional temperatureand humidity control device
1、the incoming cable wear tube
2、doorlocks(open lock)
3、door lock rain box
4、the door lock(muffled lock)
5、currenttransformer
6、the meter
7、junction box
8、Capacitors
9、switch capacitorcontactor
10、miniature circuit breaker
11、isolation switch
12、zero sequence transformer
13、leakage relay
14、Outlet AC contactor
15、outgoingairswitch
1、theincoming cable weartube 4、the doorlock(mufled lock)7、junction box 10、miniaturecircuit breaker13、leakage relay
2、doorlocks(open lock)5、currenttransformer 8、Capacitors 11、isolation switch 14、OutletAC contactor
3、doorlock rain box 6、the meter 9、switch capacitorcontactor12、zero sequence transformer15、outgoing air switch
1.The incomingcablewear tube
2.Door locks(open lock)
3.Door lock rain box
4.The door lock(muffled lock)
5.Current transformer
6.The meter
7. Junction box
8.Capacitors
9.Switch capacitor contactor
10.Miniaturecircuitbreaker
11.Zero sequence transformer
12.Leakage relay
13.Outlet AC contactor
14.Outgoing air switch
Bodysize
| Transformercapacity | Programnumber | L | W | H |
| 30-100kVA | 01、06 | 800 | 450 | 700 |
| 30-250kVA | 02、04、07、09 | 900 | 500 | 700 |
| 100~400kVA | 03、05、08、10 | 1100 | 600 | 800 |
| Transformercapacity | Programnumber | L | W | H |
| 30-100kVA | 01,06 | 600 | 450 | 1000 |
| 30-250kVA | 02,04,07,09 | 700 | 500 | 1000 |
| 100~400kVA | 03,05,08,10 | 800 | 600 | 1100 |
SC(B)10/20/35KV
Epoxy resin cast dry type transformer
Respectingpromiseandkeepingpromise,operatingintherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
Thisproductiswidelyusedinareaswhereitisparticularlysuitableforuseinlocationswherefireprotectionishigh,suchasmines oilfields,bantlssalctrsgdllitiati
Modelandmeaning
Workingconditions
installation height:nomore than 3ooomabove sea level;
power supply voltage waveform: like sine wave;
multi-phasepowersupplyvoltagesymmetry:multi-phasetransformerconnectedtothepowersupplyvoltageshouldbesymmetrical. ambient temperature:maximum temperature \looparrowleft ：the highest dailyaverage temperatureof + 3 0 C ：the highest annual average temperatureof + 2 0 0 minimumtemperature-25C(for indoor transformers).
Structuralfeatures
Core
Thecoreismadeofhigh-qualitygrain-orientedcold-rolldsliconsteesheet,45。obliquestepintotheseam,thecorewitha specialsquaretubepullplatestructure,thecorecolumnwithinsulatingtapebanding,ironcoresurfacewithspecialresincoatingto moisture and rust,effectively reducing the no-loadloss,no-load current and core noise.
Safe,flame retardant,non-polluting,can be installed directlyinthe load center.
Maintenance-free,easyto install, lowoverall operatingcosts
Moisture-proof performance,can be 100 % humidity normal operation,after the outage can be put into operation without pre-drying.
Lowlosslowpartialscarge,lowse,strongatdisspationppdwithpefecttemperaturerotectionontrolmto rovidereliable protection for the safeoperationof the transformer.
HighreliabiltAcodingtotoperationofthproducthasenputintoperationresearchproductreliabilitindexsachd theinternationaladvanced level.
Foil coil
Low-voltagewindingiththeetirecopperfoil,togetherwiththeF-classturninsulationinadedicatedlow-pressurefoilwinding aroundthesystem.Foltypecoilisgoodsolutiontothelow-voltage,ighcurentcoilwirearoundteproductshortcircuitstres, BalancepaatiotresagdtiisaingbAtey company winding end with resin poting,curing forming,moisture pollution.
Temperaturecontroldevice
TransformerusingBWDKseriesofsignalthermometer,temperaturecomponentsburiedintheupperhalfof thelow-voltagecol canautomaticallydetectandtourthethree-phasecoilofterespectiveworkinghumidityAndhasover-temperaturealarandtrip function.
Voltageconversion
Connectingpiecesindiferentgears,canachieve0kVand20kVvltageconversionrespectivelyfor10kVandVstem voltage requirements.
Themaintechnicalparameters
| Rateity (kVA) | High pressrecombinatio | Coupling standard number | Loss(kW) | No load current(%) | Smort circuit (%) | Body weight(kg) | Wwight shell(kg) | |||
| pressure (kV) | voltagetap range% | pressure (kV) | Load | No load | ||||||
| 50 | 0.4 Dyn11 | 1.23 | 0.3 | 2.3 | 490 | 580 | ||||
| 100 | 1.98 | 0.47 | 1.9 | 570 | 680 | |||||
| 160 | 2.46 | 0.58 | 1.7 | 640 | 750 | |||||
| 200 | 2.93 | 0.64 | 1.6 | 775 | 890 | |||||
| 250 | 3.4 | 0.73 | 1.5 | 895 | 1030 | |||||
| 315 | 4.06 | 0.84 1.4 | 1100 | 1250 | ||||||
| 400 | 4.82 | 1.0 | 1.3 | 1200 | 1350 | |||||
| 500 | 5.76 | 1.17 | 1.3 | 6 | 1460 | 1610 | ||||
| 630 | 6.8 | 1.32 | 1.2 | 1680 | 1840 | |||||
| 800 | 8.22 | 1.52 | 1.1 | 1800 | 1980 | |||||
| 1000 | 9.73 | 1.79 | 1.0 | 2160 | 2310 | |||||
| 1250 | 11.48 | 2.06 | 1.0 | 2520 | 2720 | |||||
| 1600 | 13.79 | 2.41 | 0.9 | 3075 | 3300 | |||||
| 2000 | 16.29 | 2.8 | 0.9 | 3670 | 3900 | |||||
| 2500 | 19.27 | 3.34 | 0.8 | 4420 | 4670 | |||||
| 5310 | 5580 | |||||||||
| 3150 | ||||||||||
| RatedCapacity(kVA) | Shapeand installationdimensions(mm) | ||||
| L | W | H | C1 | C2 | |
| 50 | 1180 | 750 | 1000 | 660 | 660 |
| 100 | 1210 | 780 | 1050 | 660 | 660 |
| 160 | 1260 | 800 | 1050 | 660 | 660 |
| 200 | 1310 | 850 | 1100 | 660 | 660 |
| 250 | 1370 | 890 | 1270 | 660 | 660 |
| 315 | 1420 | 890 | 1330 | 660 | 660 |
| 400 | 1450 | 900 | 1380 | 660 | 820 |
| 500 | 1470 | 900 | 1480 | 660 | 820 |
| 630 | 1545 | 950 | 1595 | 820 | 820 |
| 800 | 1600 | 980 | 1650 | 820 | 820 |
| 1000 | 1620 | 1050 | 1760 | 820 | 820 |
| 1250 | 1760 | 1050 | 1800 | 820 | 820 |
| 1600 | 1800 | 1070 | 1850 | 820 | 820 |
| 2000 | 1850 | 1100 | 1650 | 820 | 820 |
| 2500 | 1900 | 1160 | 1700 | 820 | 820 |
| 3150 | 1980 | 1240 | 1850 | 820 | 820 |
Overview
S10transformerisa1kVclassS10seriesfullsealedtransformer.Itintroducesthenewtechnologyandadoptsafllyleld sealedtypewithoutoilstoragecabinet.Thetransformerchangesitsoilbodyduetochangesintemperatureandload,whichis completely regulateby theelasticityof the transformeroil tank.
| Rating (kVA) | Voltage group | Vector group | Impedance voltage | Loss | No-load | Weight(kg) | (L×B×H)(mm) Outer dimension | Gauge hvrtioal | ||||
| Vigh-e | vLitwge | No-load | load | current | Machine | weight Grosst | ||||||
| 5 | 0.07 | 0.35 | 4 | 50 | 45 | 145 | 550×450×800 | 400/350 | ||||
| 10 | 13.8 | 0.09 | 0.40 | 3.5 | 70 | 55 | 185 | 550×450×800 | 400/350 | |||
| 20 | 0.11 | 0.52 | 3.0 | 110 | 60 | 235 | 660×505×850 | 400/350 | ||||
| 30 | 0.13 | 0.63/0.6 | 2.3 | 130 | 65 | 265 | 660×530×870 | 450/340 | ||||
| 0.17 | 0.91/0.87 | 2.0 | 195 | 80 | 365 | 740×600×930 | 450/380 | |||||
| 50 63 | 0.20 | 1.09/1.04 | 1.9 | 230 | 80 | 400 | 720×620×100 | 450/380 | ||||
| 80 | 0.25 | 1.31/1.25 | 1.9 | 260 | 95 | 460 | 770×640×1030 | 450/430 | ||||
| 100 | 4 | 0.29 | 1.58/1.5 | 1.8 | 300 | 95 | 510 | 820×710×970 | 550/450 | |||
| 125 | 0.34 | 1.89/1.8 | 1.7 | 335 | 115 | 585 | 1040×680×1080 | 550/470 | ||||
| 160 | 13.2 0.4 | 0.40 | 2.31/2.2 | 1.6 | 405 | 130 | 685 | 1090×670×1130 | ||||
| 200 | 11 | 0.48 | 2.73/2.6 | 1.5 | 490 | 150 | 810 | 550/520 1160×760×1090 550/520 | ||||
| 250 | 10.5 | 0.56 | 3.2/3.05 | 1.4 | 565 | 170 | 935 | 1215×775×1180 650/550 | ||||
| 315 | 10 | 0.67 | 3.83/3.65 | 1.4 | 655 | 200 | 1095 | 1345×890×1205 650/550 | ||||
| 400 | 0.80 | 4.52/4.3 | 1.3 | 840 | 250 | 1385 | 1450×935×1240 | |||||
| 6 | 0.96 | 5.41/5.15 | 1.2 | 935 | 235 | 1505 | 1410×970×1290 | 650/550 750/600 | ||||
| 500 630 | 1.20 | 6.2 | 1.1 | 1100 | 330 | 1830 | 1595×1040×1315 | |||||
| 800 | 1.40 | 7.5 | 1.0 | 1360 | 370 | 2225 | 1765×1170×1350 | 850/660 850/660 | ||||
| 1000 | 1.70 | 10.3 | 1.0 | 1455 | 475 | 2555 | 1855×1255×1490 | 850/660 | ||||
| 1250 | 1.95 | 12.0 | 0.9 | 1715 | 545 | 3140 | 1885×1270×1590 | 850/660 | ||||
| 1600 | 4.5 | 2.40 | 14.5 | 0.8 | 2095 | 630 | 3680 | 1950×1620×2020 | 850/700 | |||
| 2000 | 2.80 | 19.8 | 0.8 | 2340 | 715 | 4190 | 2060×1740×2050 | 820/820 | ||||
| 2500 | 3.30 | 23.0 | 0.7 | 2920 | 830 | 5100 | 2250×1800×210 | 1070/1070 | ||||
Standard
GB1094.1-2013;GB1094.2--2013;GB1094.3--2013;GB1094.5--2008;GB/T6451-2008;GB/1094.10--2003;JB/10088- 2004:IEC60076;SANS780STANDARDS
FeaturesofProducts
1.MeetorexceedsANSI.IEC.GB.SANS.Standards
2.Safe Handling,Installationand Operation.
3.Attractive,modern appearance
4.Reasonable Structure
5. Fully- sealed
6.Higher system reliability
7.Highsecurityand reliabilityinoperation
8.High capacity of overload and efficiency
9.Robust construction having excellent short circuit and thermal withstand capabilities
10.Transformers are more efficient by reduced no-load losses and Reduced load losses
S10seriesthreephase distributiontransformer
Overview
15/20kVDistributionTransformersrefertoastaticelectricalaplianceinapowerdistributionsystemthatconvertsACvoltage andcurrentacordingtothelawofelectromagneticinductiontotransmitACpower.InsomeareaspowerTransformerswithavoltage levelbelow 2 0 \mathsf { k V } arecalled "distributionTransformers"or"blending"forshort.Theinstallationof'matched"placesandplacesis botha substation.Distribution Transformers should be installed on the column or open floor installation.
FeaturesofProducts
1.MeetorexceedsANSI.IEC.GB.SANS.Standards
2.Safe Handling, Installation and Operation.
3.Attractive,modern appearance
4.Reasonable Structure
5. Fully-sealed
6. Higher system reliability
7.Highsecurityand reliability inoperation
8.High capacity of overload and efficiency
9.Robust construction having excellent short circuit and thermal withstand capabilities
10.Transformers are more eficient by Reduced no-load lossesand Reduced load losses
Transformernormalserviceconditions
1.The height above the sea level is below 1000m;
2.Ambient temperature;
3.Highest air temperature + 4 0 ^ { \circ } \mathsf C .
4.Highestdailyaverageairtemperature + 3 0 ^ { \circ } C ：
5.Highestannual averageair temperature + 2 0 ^ { \circ } C ：
6.Lowest outdoorair temperature - 2 5 ^ { \circ } C .
| Rating (kVA) | Voltagegroup | Vector vLow-e group | Impedance | Loss | No-load | Weight(kg) | (L×B×H)(mm) Outerdimension | Gauge hverticatal | ||||
| VHigh-e | voltage | No-load | load current | Mwchine | weight | Grogst | ||||||
| 50 | 24 20 | 0.4 Yyno | Dyn11 5.5 | 0.17 | 1.15 | 2.0 | 200 | 145 | 465 | 920×610×1000 | 450/380 | |
| 0.23 | 1.92 | 1.8 | 330 | 165 | 635 | 920×680×1100 | 550/450 | |||||
| 0.27 | 2.26 | 1.7 | 395 | 185 | 745 | 960×780×1120 | 550/470 | |||||
| 125 160 | 0.29 | 2.69 | 1.6 | 505 | 205 | 885 | 1160×710×1180 | 550/520 | ||||
| 200 | 0.34 | 3.16 | 1.5 | 580 | 225 | 995 | 1190×730×1190 | 550/520 | ||||
| 250 | 0.41 | 3.76 | 1.4 | 695 | 245 | 1130 | 1280×820×1210 | 650/550 | ||||
| 315 | 0.49 | 4.53 | 1.4 | 745 | 260 | 1285 | 1380×910×1240 | 650/550 | ||||
| 400 22 | 0.58 | 5.47 | 1.3 | 865 | 305 | 1500 | 1430×950×1320 | 650/550 | ||||
| 500 | 0.69 | 6.58 | 1.2 | 985 | 335 | 1710 | 1520×1020×1360 | 750/600 | ||||
| 630 | Dyn5 | 0.83 | 7.87 | 1.1 | 1165 | 385 | 2010 | 1680×1150×1380 | 850/660 | |||
| 800 | 19 | 0.433 | 0.98 | 9.41 | 1.0 | 1335 | 415 | 2315 | 1810×1280×1430 | 850/660 | ||
| 1000 | 1.15 | 11.54 | 1.0 | 1655 | 515 | 2985 | 1840×1290×1540 | 850/660 | ||||
| 1250 | 1.4 | 13.94 | 0.9 | 1890 | 630 | 3460 | 1850×1300×1730 | 850/660 | ||||
| 1600 | 1.7 | 16.67 | 0.8 | 2220 | 710 | 4015 | 1920×1350×1790 | 850/700 | ||||
| 2000 | 2.18 | 20.43 | 0.8 | 2530 | 730 | 4425 | 2020×1770×2040 | 820/820 | ||||
| 0.8 | 3165 | 795 | 5260 | 2080×1800×21301070/1070 | ||||||||
| 2500 | 2.56 | 21.85 | ||||||||||
S11 series 33kV class oltc power transformer
Respectingpromiseandkeepingpromise,operatingintherightway，striving for perfection,coexistenceandwin-winsituation
Overview
S11series15/2OkVDistributionTransformersrefertoastaticelectricalaplianceinapowerdistributionsystemthatconvertsAC voltageadcurrntaccodingtotelawofectromagneticinductiontotransmitACpowerInsomeareas,owerTransformersitha voltage levelbelow 2 0 \mathsf { k V } arecalled "distribution Transformers"or"blending"forshort.The instalationof'matched"placesand places is both a substation.Distribution Transformers should be installed on the column or open floor instalation.
FeaturesofProducts
1.Meet orexceeds ANSI.IEC.GB.SANS.Standards
2.Safe Handling,Installationand Operation.
3.Attractive,modern appearance
4.Reasonable Structure
5.Fully-sealed
6. Higher system reliability
7.High security and reliability in operation
8.High capacity of overload and efficiency
9.Robust construction having excellent short circuit and thermal withstand capabilities
10.Transformers are more efficient by reduced no-load losses and Reduced load losses
Transformernormalserviceconditions
1.The heightabove thesea level isbelow1000m;
2.Ambient temperature;
3.Highest air temperature + 4 0 \mathsf { C } ^ { \circ }
4.Highest dailyaverageair temperature + 3 0 0 ^ { \circ } ：
5.Highest annual averageairtemperature + 2 0 0 ^ { \circ } ：
6.Lowest outdoorair temperature -25C;
| Rating (kVA) | Voltage group | Vector | Impedance voltage | Loss | No-load current | Weight(kg) | (L×B×H)(mm) Outerdimension | Gauge hvritioatl | ||||
| VHigh-e | Low-e group | No-load | load | Machine | weight | Grost | ||||||
| 800 | 36 | 11 | Yd11 | 6.5 | 1.3 1.52 | 10.4 | 1.0 | 1350 | 700 | 2780 | 2790×1220×2150 | 820/820 |
| 1000 | 12.8 | 1.0 | 1575 | 775 | 3290 | 2830×1240×2250 | 820/820 | |||||
| 1250 | 1.86 | 15.4 | 0.9 | 1810 | 880 | 3845 | 2870×1310×2370 | 820/820 | ||||
| 1600 | 2.24 | 18.43 | 0.8 | 2190 | 960 | 4295 | 2900×1510×2420 | 820/820 | ||||
| 2000 38.5 | 2.88 | 20.25 | 0.7 | 2460 | 1090 | 4890 | 2920×1750×2450 | 820/820 | ||||
| 2500 | 3.4 | 21.73 | 0.6 | 3010 | 1205 | 5660 2980×1840×2530 | 1070/1070 | |||||
| 3150 | 4.04 | 26.01 | 0.56 | 3785 | 1500 | 7600 | 3150×2220×2620 | 1070/1070 | ||||
| 4000 | 10 | 7.0 | 4.84 | 30.69 | 0.56 | 4690 | 1790 | 8500 | 3270×2390×2670 | 1070/1070 | ||
| 35 5000 34.5 | 5.8 | 36.00 | 0.48 | 5570 | 2015 | 9790 | 3470×2450×2750 | 1070/1070 | ||||
| 6 | 7.04 | 38.7 | 0.48 | 7380 | 2460 | 12620 | 3700×2580×2950 | 1475/1475 | ||||
| 6300 8000 | 33 | Yd11 | 4.5 | 9.84 | 42.75 | 0.42 | 8870 | 2650 | 14100 | 3850×2680×3150 | 1475/1475 | |
| 11.6 | 50.58 | 0.42 | 10020 | 2930 | 16500 | 3920×2720×3230 | 1475/1475 | |||||
| 13.66 | 59.85 | 0.4 | 12880 | 3710 | 19780 | 4010×2950×3410 | 1475/1475 | |||||
| 12500 16000 | 8.0 | 16.46 | 74.02 | 0.4 | 16120 | 4280 | 23950 | 4120×3180×3570 | 1475/1475 | |||
| 20000 | 19.46 | 87.14 | 0.4 | 18580 | 5230 29600 | 4330×3560×3990 | ||||||
| 1475/1475 | ||||||||||||
ZN63(VS1)-12
Fixed/Handcart Indoor High Voltage Vacuum Circuit Breaker
Respectingpromiseandkeepingpromise,operatingintherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
TheZN63(VS1)-12 series indoorfixed/handcart type high-voltagevacuum circuit breaker isathree-phase AC 5 0 H z indoor switchgearwitharatedvoageof2kVItcanbeusedforontrolandprotectioofidusrialandminingenterprisesowerlantsnd substatios,electricafcilindissitableforfreuentoerationplaces.Byintegratingteratingmechanismithcit breakerbodyitcanbedesignedasafiednstaltionunitorquippedwithdedicatedpropulsionmechanismtoforaandartnit foruse.Theaincircuitcanbequippedwithintegralfixedpoletoachieveminaturizationigheliabilityndmaintenancreef circuit breakers.Itcanbeusedwith KYN28A-12(GZS)andothermidmountedhandcarttypeswitchgearandcanalsobeusedwith XGN series fixed switchgear.
Modelandmeaning
Normalcondition
Theambient air temperature shall not exceed 4 0 ~ ^ { \circ } \mathsf { C } ,and the average value measured within 24 hours shall not exceed 3 5 ^ { \circ } C ,with a minimumambientairtemperatureof . 1 5 ^ { \circ } C ：
Altitude: not exceeding 3 0 0 0 m
Thesurroundingairisnotsignificantlypollted bydust,smoke,corrosive,flammable gases,vapors,orsaltspray;
Humidity conditions:The average relative humidity should not exceed 9 5 % ,theaverage monthly relative humidity should not exceed （204號 9 0 % ,theaverage water vapor pressure should not exceed 2 . 2 \mathsf { k P a } ,and the average monthly water vapor pressure should not exceed 1 . 8 \mathsf { k P a } ：
Vibration or ground motion from outside the switchgear and control equipment can be ignored;
Theamplitude of electromagnetic interference induced in the secondary system shall not exceed 1.6kV.
ProductTechnicalFeatures
1.Theoverall performance of thecircuit breaker issuperior
Thearcextinguishingchamberandoperatingmechanismofthecircuitbreakerareconfiguredinafrontobackmanerandconnected asawhole througha transmission mechanism.
Themechanical lifespancanreachup to 3ooo0 cycles.
2.Advanced vacuum arc extinguishing chamber
Sealed ceramic vacuum arc extinguishing chamber.
Thecopperchromiumcontactmaterialandlongitudinalmagneticfield contactstructure arearcextinguishing methods.
3.Enhanced insulation cylinder
The insulation cylinder is formed using the APG new process.
Addinginnerskirtsandreinforcingribstothensulationcylinderimprovestheinsulationlevelandresistancetodynamicstablecurrent Thevacuumarcextinguishingchamberisinstalledinsidetheinsulationcylinder，efectivelypreventingdamageandsurface contaminationcaused by foreignobjects,while significantlyreducing theoverallsizeof the circuit breaker.
4.Flexibleandeasyto operate functions
Theoperating mechanismadoptsaspringenergystorage type,which has twofunctions:electricand manualenergystorage.
Theenergystoredintheenergystoragespringduringtheoperationofthecircuitbreakeristransmitedtotheconnectingrod mechanismthroughtheoutputcam,andthen transmitedtothemovingcontactpartroughtheconnectingrodmechanism.
Advanced and reasonable buffering device,no rebound whenopening,reduces the impactand vibration of opening.
Noneed foradjustment,minimal orminimalmaintenance.
Appearanceandinstallationdimensions
Appearanceandinstallationdimensions
| L1(mm) | L2(mm) | L3(mm) | L4(mm) | |
| Cooperate with a 210mm phase spacing | 320 | 294 | 45 | 370 |
| Cooperate with a 275mm phase spacing | 400 | 294 | 45 | 370 |
ZN85-40.5
Indoor high-voltage vacuum circuit breaker
Respectingpromiseandkeepingpromise,operating intherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
TheZN85-40.5seriesindoorhig-voltagevacuumcircuitbreaker (hereinafterreferrdtoasthecircuitbreaker)issuitableforuse in three-phase AC 5 0 H z ratedvoltage 4 0 . 5 \mathsf { k V } powersystems,and can be used for load current,overload current,and fault current in industrialndminingnterpises,powerplants,andsubstationsTeicuitbreakerndoperatingmechanismarearangedcal effectivelyreducing thedepthof the circuitbreaker.
Thethre-phasearcextinguishingchamberandasociatedchargedbodyareisolatedbythreeindependent epoxyresininsulation cylinders,foringacompositeinsulationstructure.Theicuitbreakermetstherequirementsofairdistanceandcreepagedistance undernormaloperatingconditions,andefectivelyreducestheVolumeofthecircuitbreaker.Themainelectricalircuitvacumarc extinguishingchamberandthedynamicandstaticcoductivecoectionareistaledinsidetheisulationcylnderithaase spacing of only 3 0 0 \mathsf {mm } .The main circuit electrical connectionsareallfixed connections,which have high reliability.The insulation cylinder is installed above the circuit breaker frame.
Thespringoperatedmechanismspeciallydesignedforthisnewtypeofcircuitbreakerisinstaledinsidethecircuitbreakerframe, anditsstructuralcaracteristicsaremoresuitablefortheupperandlowerlayoutofthecircuitbreakerndbecomeanintegralpartof theoverallstructureoftecircuitbreakerTemechanismdsignissimpleandtheoutputcureanditsperformancearemoresuitable for the characteristics and requirements of 4 0 . 5 \mathsf { k V } vacuum circuit breakers.The overall layout isreasonable,beautiful,and concise. Smallsize,flexibleoperationreliableelectricalperformance,longservicelifeasymaintenance,andmaintenancefreemecanism. Thiscircuit breaker issuitable forfrequentoperation,variousoccasions,andplaces with harshoperating conditions.
Modelandmeaning
Normalcondition
Surrounding air temperature:not exceeding 4 0 ~ ^ { \circ } C ;Thedailyaverage temperaturedoes not exceed 3 5 ^ { \circ } \mathsf { C } ;The minimum ambient air temperatureis - 1 5 ^ { \circ } C ：
Relative humidityof theair:dailyaveragenot exceeding 9 5 % ，monthlyaveragenotexceeding 90 % ：Thedailyaveragevalueofwatei vaporpressureshall not exceed 2 . 2 \mathsf { k P a } ：Themonthlyaveragevalueisnot greater than 1 . 8 \mathsf { k P a }
Altitude:not exceeding 1 0 0 0 \mathsf { m } ：
There is no obvious pollution from dust,smoke,corrosive,flammable gases,steamorsalt spray around;
Vibration or ground motion from outside the switchgear and control equipment can be ignored;
Theamplitude of electromagnetic interference induced in te secondary system shall not exceed 1.6kV;
Theinstallation location forspecial use conditions isatanaltitude exceeding 1 0 0 0 { m } ，wheretheambientairtemperatureexceedsthe limit specifiedfornormaluseconditions,orwherehighhumidityispronetocondensation.Pleaseconsultwithusforcustomization.
Executionstandards
GB1984-2003HighVoltageACCircuitBreakers
GB/T11022-1999 Common Technical Requirements for High Voltage Switchgear and Control Equipment Standards
IEC62271-100 High VoltageACCircuit Breakers
ProductTechnicalFeatures
1.Theoverallperformanceof thecircuit breaker issuperior
Theoverallstructreoftcuitbeakerismplendasonablendtrcingsngambenterloindig partsare arranged vertically.
Specialized spring operated mechanism,no need for adjustment,stable and reliable action.
Theinstalltonfisfreeandflexibleincudinginstallaioinsidetepull-outandcartabtandfiedinstallationwithside mechanism layout.
2.High reliability insulation cylinder
Theinsulationcylinderismadeofepoxyresinwithreliablemechanicalandelectricalpropertiesthroughamaturevacuumcasting process.
Thevacumarcetingsingambeisrngedisdeoedisulatiocyldeinifantliprovingteisulationpc avoidingtheinfunceofrshxtealenvioentsndefetielypreventingustandforeigectsfromenteringthinicit. Significantly reduce the overall sizeof thecircuit breaker.
3.Advanced vacuum arc extinguishing chamber
ThepreferredWL-35855Xvacuumarcextinguishingchambercomesfrom thequaityassuranceofCutlerHammercompanyinthe United States.
Optionalcoiltypeverticaltrongmagneticfeldstructurevacuumarcextinguishingchamberusingceramicshellcoppercromum contactmaterialaletealimsisghationvelogcingsngbilitylngricalif performance in breakingand closing short-circuitcurrent.
4.Optional sealing process
Themainelectricalcircuitoftheicuitbreakerdoptssldsealingtechnlogndthevacuumarcetinguisingchamberisoured nto the insulation cylinder.
The insulation strength is greatly improved.
Typicalwiringscheme
| SerialNumber | project | unit | data |
| 1 | Rated voltage | KV | 40.5 |
| 2 | 1-minute power frequency withstand voltage (effective value) | kV | 95 |
| 3 | Lightning impulse withstand voltage (peak value) | kV | 185 |
| 4 | Rated frequency | Hz | 50 |
| 5 | Ratedcurrent | A | 1250，1600,2000 |
| 6 | Rated short-time withstand current | kA | 25,31.5 |
| 7 | Rated peakwithstandcurrent | kA | 63,80 |
| 8 | Rated short-circuit duration | S | 4 |
| 9 | Ratedshort-circuitbreakingcurrent | kA | 25,31.5 |
| 10 | Rated short-circuitclosingcurrent | kA | 63,80 |
| 11 | Ratedoperatingsequence | O-0.3s-CO-180s-CO | |
| 12 | Cut off time | ms | |
| 13 | Ratedshort-circuitbreakingcurrent breaking times | order | 20 |
| 14 | Singlecapacitorbankbreakingcurrent | A | 630 |
| 15 | Back to back capacitor bank breaking current | A | 400 |
| 16 | Rated operating voltage | V | AC110,220;DC110,220 |
| 17 | Mechanical lifespan | order | 10000 |
